PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g096320.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 240aa    MW: 27267.2 Da    PI: 4.9259
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g096320.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.6e-194596556
                        SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++f++eq++ Le++Fe + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Sopim01g096320.0.1 45 RRFSDEQIKSLETMFETETKLEPRKKLQLARELGLQPRQVAIWFQNKRARWK 96
                        48*************************************************9 PP

2HD-ZIP_I/II124.54.9e-4044134393
         HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                          rr+s+eq+k+LE++Fe+e+kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE+dy+ Lk++yd+l+++ e+L+ke+++L  +l++
  Sopim01g096320.0.1  44 ARRFSDEQIKSLETMFETETKLEPRKKLQLARELGLQPRQVAIWFQNKRARWKSKQLERDYSILKSNYDNLASQYEALKKEKQSLLIQLQK 134
                         69***********************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.19E-1922100IPR009057Homeodomain-like
PROSITE profilePS5007116.523898IPR001356Homeobox domain
SMARTSM003897.9E-1641102IPR001356Homeobox domain
CDDcd000861.82E-154599No hitNo description
PfamPF000461.9E-164596IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1945105IPR009057Homeodomain-like
PRINTSPR000319.7E-66978IPR000047Helix-turn-helix motif
PROSITE patternPS0002707396IPR017970Homeobox, conserved site
PRINTSPR000319.7E-67894IPR000047Helix-turn-helix motif
PfamPF021835.2E-1798138IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MFDTGEFSPS SSTAAVSAEC FSSSSCFSSL SSSKKKKIHS SNNARRFSDE QIKSLETMFE  60
TETKLEPRKK LQLARELGLQ PRQVAIWFQN KRARWKSKQL ERDYSILKSN YDNLASQYEA  120
LKKEKQSLLI QLQKLKEIES DNRCSVIKKN EMEGMPSLSF DLSSQHGTNG VMSDDDIDSS  180
IRADYLGLDD DAEYHLLKIV ETGDSSLTSP ENWGCLDDDG ILNHQPNSSS YDQWWDFWS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230017.11e-176PREDICTED: homeobox-leucine zipper protein ATHB-12
SwissprotP468974e-66ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLK4B0201e-176K4B020_SOLLC; Uncharacterized protein
STRINGSolyc01g096320.2.11e-176(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.26e-50homeobox 7